"matrix modifier"

Supplier: Ricca Chemical

1.0% Palladium. Used to support Inductively coupled plasma (ICP) analysis to sharpen the contrast and improve the readability. 50mL.

Supplier: Prosci

Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq].

Supplier: Cytiva

IMAC Sepharose 6 Fast Flow is composed of cross-linked 6% agarose beads modified with a novel chelating ligand immobilized to the base matrix.

Supplier: Cytiva

Chelating Sepharose Fast Flow is composed of cross-linked 6% agarose beads modified with iminodiacetic immobilized to the base matrix by stable ether linkages and sufficiently long spacer arms.

Supplier: Cytiva

SOURCE 30S is a synthetic high performance, preparative, chromatography medium, based on a 30 µm monosized, rigid polystyrene/divinyl benzene polymer matrix It is modified with sulphonate (S) strong cation exchange groups.

Supplier: Advanced Biomatrix

HyStem® Hydrogel Kit - The growth factor delivery matrix

Supplier: Aladdin Scientific

TentaGel® resins are grafted copolymers consisting of a low crosslinked polystyrene matrix on which polyethylene glycol (PEG or POE) is grafted via an ethyl ether group which increases stability towards acid treatment and minimizes PEG-leaching. The graft copolymer shows modified physicochemical properties which are highly dominated by the PEG moiety (and no longer by the polystyrene matrix) and has hydrophobic and hydrophilic properties. These copolymers are pressure stable and can be used in batch processes as well as under continuous flow conditions. The PEG spacer is in the range of MW 3000 Da. TentaGel® resins have high diffusion rates and excellent swelling in a wide range of solvents from e.g. toluene to water.

Supplier: Goodfellow

30% Glass Fiber Reinforced PPO (modified) Rods are available in 11 variations, with differences in diameter and length to suit different applications. This composite material combines glass fibers with a polyphenylene oxide polymer matrix, resulting in rigid and dimensionally stable rods with good chemical resistance. Potential applications for 30% Glass Fiber Reinforced PPO include structural components, spacers and wear-resistant mechanical parts, where the material's stiffness, strength and thermal stability are desirable. With their range of sizes and properties, these composite rods provide versatile solutions across industrial and scientific settings.

Supplier: Anaspec

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Advanced Biomatrix

Heprasil® is a mixture of thiol-modified hyaluronic acid thiol-modified heparin. Heprasil® is a component of the HyStem®-HP kits, but can be purchased separately here.

Supplier: Proteintech

Epigenetic modifications and dynamic changes in chromatin organization by organizer proteins have recently been shown to play an instrumental role in regulating cancer-promoting genes. Special AT-rich binding protein (SATB1) is a unique type of global regulator that integrates higher-order chromatin organization -withregulation of gene expression. SATB1 is a T cell-enriched transcription factor and a chromatin organizer essential for controlling genes that participate in T-cell development and activation. It regulates gene expression by periodically anchoring matrix attachment regions to the nuclear matrix and directly recruiting chromatin-modifying factors. Depending on its posttranslational modifications, SATB1 activates or represses multiple genes.Its expression is regulated by interleukin-4 (IL4) during T helper-2(Th2) cell differentiation.

Supplier: Proteintech

LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.

Supplier: Proteintech

LONP1(Lon protease homolog, mitochondrial) is also named as LONP, LONHS, HLON, LON, PRSS15, PIM1, MGC1498 and belongs to the peptidase S16 family. It seems to play a major role in the elimination of oxidatively modified proteins in the mitochondrial matrix. LONP1, also a nuclearly encoded and mitochondrially located stress-responsive protease, is involved in heme-mediated ALAS-1 turnover. It recognizes specific surface determinants or folds, initiates proteolysis at solvent-accessible sites, and generates unfolded polypeptides that are then processively degraded.

Supplier: Rockland Immunochemical

CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.

Supplier: Rockland Immunochemical

CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.

Supplier: MP Biomedicals

Use of dextrans as long and hydrophilic spacer arms improves the performance of immobilized proteins acting on macromolecules. Dextrans are used in many applications as platelet aggregants, plasma volume extenders, osmotic pressure regulators, stabilizers, organ separation media, matrix components, copolymers, microcarriers, binding agents, viscosity modifiers, antithrombotics, lubricants and physical structure components. They may be used as long hydrophilic spacer arms to improve the performance (freedom of movement) of conjugated/bound proteins. Dextrans may be derivatized for use in biosensor systems.
Dextran is branched polysaccharide made up of linear α (1→6) linked glucose units and α (1→3) link initiated branches; it ranges in size from 10,000 to 150,000 Kd.Depending upon its molecular weight it has different uses in different fields.
Physical Appearance: White powder
Solubility: Very soluble in water (50 mg/mL), slightly soluble in alcohol