"hplc+vial"

Supplier: Anaspec

This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Chem-Impex International

tert-Butyl-n-(6-methoxy-3-pyridyl)carbamate is a key compound in pharmaceuticals and agrochemicals, known for its protective properties in organic synthesis and effectiveness in herbicide formulations. Its unique structure enhances reactivity, making it ideal for drug development and environmentally friendly agricultural products.

Supplier: Chem-Impex International

4-Fluoro-L-phenylalanine ethyl ester hydrochloride is a key compound in drug development, enhancing biological activity in peptide synthesis and therapeutic applications. Ideal for researchers in medicinal chemistry and pharmaceutical innovation.

Supplier: Chem-Impex International

5-Bromo-1,6-dimethyl-1H-indazole is a key compound in pharmaceutical research, known for its potential in developing anti-cancer drugs and as an intermediate in organic synthesis. Its unique structure enhances reactivity, making it valuable for drug discovery and agrochemical applications.

Supplier: Anaspec

The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: ACRO Biosystems

Human CEACAM-5 Protein, Fc Tag (HPLC verified), Source: expressed from human 293 cells (HEK293). It contains AA Lys 35 - Ala 685, Predicted N-terminus: Lys 35, protein carries a human IgG1 Fc tag at the C-terminus, Synonyms: CEACAM-5, CD66e, CEA, Meconium antigen 100, Size: 100uG

Supplier: Anaspec

This peptide is Histone H3 amino acid residues 1 to 21. It is trimethylated at lysine 9 with a C-terminal GG linker, followed by a biotinylated lysine. The methylation of histone H3 at lysine is an important epigenetic mark of transcriptional silencing a
Sequence:ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2764.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death
Sequence:GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
MW:4103.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Chem-Impex International

Fmoc-L-aspartic acid a-9-fluorenylmethyl ester is a key amino acid derivative for peptide synthesis, enhancing stability and solubility. Ideal for pharmaceutical applications and automated synthesis, it streamlines research and development processes.

Supplier: Chem-Impex International

Ethyl 4-oxo-4H-chromene-2-carboxylate is a key compound in organic synthesis, offering applications in pharmaceuticals, materials science, and bioactive molecule development. Its unique structure supports innovative research and product development.

Supplier: Chem-Impex International

Boc-O-benzyl-L-serine 4-nitrophenyl ester is essential for peptide synthesis and drug development. Its stability and reactivity make it ideal for creating bioactive compounds, enhancing research efficiency. Perfect for medicinal chemistry applications.

Supplier: VWR International

General purpose column, ideal as confrmation column.

Supplier: VWR International

Max temperature limits may change depending on the film thickness.

Supplier: IXCELLS BIOTECHNOLOGIES USA MS

Rat Tail-Tip Fibroblasts isolated from rat tails; Frozen

Supplier: Chem-Impex International

Boc-1,5-diaminopentane is a key reagent in organic synthesis and pharmaceutical research, ideal for peptide synthesis and drug development. Its unique structure enhances stability and solubility, making it a versatile choice for creating complex molecules and functionalized polymers.

Supplier: Chem-Impex International

4-Nitro-DL-phenylalanine hydrate is a key amino acid derivative used in pharmaceutical research and drug development. Its unique properties facilitate studies in neuropharmacology and protein synthesis, making it essential for researchers seeking innovative therapeutic solutions.