17470 Results for: "growth factor"

Supplier: Thermo Scientific Chemicals

Fibroblast Growth Factor 10, human

Supplier: Thermo Scientific Chemicals

Vascular Endothelial Growth Factor-165, mouse

Supplier: Thermo Scientific Chemicals

Epidermal Growth Factor Receptor Peptide (985-996)

Supplier: Corning

Epidermal growth factor (EGF) is a low-molecular weight mitogenic protein that stimulates proliferation of a wide variety of cell types in vitro. EGF can also be used for receptor, gene expression, wound healing studies, and to culture cells in reduced-serum or serum-free culture systems.

Supplier: Prosci

Hepatocyte growth factor/scatter factor (HGF/SF) is a paracrine cellular growth, motility and morphogenic factor. It belongs to the peptidase S1 family and Plasminogen subfamily, contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. HGF regulates cell growth, cell motility, and morphogenesis by activating a tyrosine kinase signaling cascade after binding to the proto-oncogenic c-Met receptor. HGF is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. Its ability to stimulate mitogenesis, cell motility, and matrix invasion gives it a central role in angiogenesis, tumorogenesis, and tissue regeneration.

Supplier: Thermo Scientific Chemicals

Fibroblast Growth Factor 7, human

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: AFG Bioscience

Bovine Growth/Differentiation Factor 8 (MSTN) ELISA Kit, AFG Bioscience

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Enzo Life Sciences

Produced in E. coli. A non-glycoylated protein containnig 53 amino acids.

Supplier: AFG Bioscience

Rat Transforming Growth Factor α (TGF-α) ELISA Kit, AFG Bioscience

Supplier: AFG Bioscience

Mouse Transforming Growth Factor α (TGF-α) ELISA Kit, AFG Bioscience

Supplier: Anaspec

This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Bioss

Bovine Nerve Growth Factor (NGF) ELISA Kit

Supplier: Bioss

May be involved in the regulation of cell-cell interactions or in synatogenesis during the maturation of the nervous system. NERP peptides are involved in the control of body fluid homeostasis by regulating vasopressin release. Antimicrobial peptide VGF[554-577]: Has bactericidal activity against M. luteus, and antifungal activity against P. Pastoris.

Supplier: Prosci

Hepatoma-Derived Growth Factor is a original member of the HDGF family. HDGF is a cytoplasmic protein and contains one PWWP domain. HDGF expression levels are high in the nucleus and cytoplasm of smooth muscle and endothelial cells. HDGF has proliferative, angiogenic and neurotrophic activity. HDGF was initially characterized as a secreted mitogen from the Huh-7 human hepatoma cell line. As a heparin-binding protein, which is highly expressed in tumor cells where it stimulates proliferation. HDGF has mitogenic activity for fibroblasts and acts as a transcriptional repressor. It has been shown that HDGF is linked with tumorigenesis and the growth of cancer.

Supplier: Corning

Basic Fibroblast Growth Factors (bFGF), human recombinant, are heparin-binding mitogenic proteins that enhance proliferation of a wide variety of cell types under serum-free or serum-reduced conditions.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: AFG Bioscience

Human Vascular Endothelial Growth Factor (VEGF) ELISA Kit, AFG Bioscience

Supplier: Enzo Life Sciences

Produced in E. coli. Non-glycosylated protein, containing 54 amino acids, with a molecular weight of 6.3 kDa.

Supplier: Bon Opus Biosciences

Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: Bioss

May be involved in the regulation of cell-cell interactions or in synatogenesis during the maturation of the nervous system. NERP peptides are involved in the control of body fluid homeostasis by regulating vasopressin release. Antimicrobial peptide VGF[554-577]: Has bactericidal activity against M. luteus, and antifungal activity against P. Pastoris.

Supplier: Corning

Transforming Growth Factor-beta (TGF-beta) is a multi-functional protein that plays a central role in the regulation of cell growth and differentiation with either stimulatory or inhibitory effects, depending on the context of its action.

Supplier: Antibodies.com

Mouse beta Nerve Growth Factor ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the in vitro quantitative determination of mouse beta Nerve Growth Factor in serum, plasma, tissue homogenates, and other biological fluids.

Supplier: AFG Bioscience

Bovine Heparin-Binding Growth Factor 2 (FGF2) ELISA Kit, AFG Bioscience

Supplier: AFG Bioscience

Human Epidermal Growth Factor (EGF) ELISA Kit, AFG Bioscience