586157 Results for: "SUTURE,+VICRYL+UD+BR+CT+3-0+2+7\\\\\\\"+FSL"

Supplier: Healthcare Products

Absorbable sterile synthetic sutures feature exclusive coating technology for smooth passage through tissue, ease of knot tying, unsurpassed knot-sliding capabilities, and virtually no package memory for easier handling

Supplier: Healthcare Products

Nonabsorbable, sterile, surgical sutures are composed of an organic protein called fibroin, which is derived from the domesticated species Bombyx mori (B

Supplier: Healthcare Products

Nonabsorbable, braided, sterile surgical sutures are composed of polyethylene terephthalate

Supplier: Healthcare Products

Strong absorbable sterile sutures feature easier handling with minimal out-of-package memory and smooth passage through tissue

Supplier: Healthcare Products

Nonabsorbable, braided, sterile, surgical sutures are composed of polyethylene terephthalate

Supplier: Roboz Surgical

Rhoton Forceps; Micro Suturing With Tying Platform; Curved; 7" Length 0.3 mm Tip Width.
Rhoton forceps can be used in a variety of surgical situations. The feature of this instrument is its long, narrow tip which is helpful in procedures where you need to grasp and manipulate fine, small tissue in deep cavities.

Supplier: AFG Bioscience

Human Follistatin-like 1 (FSL-1) ELISA Kit, AFG Bioscience

Supplier: Adipogen

FSL-1 (Pam2CGDPKHPKSF) is a synthetic lipoprotein that represents the N-terminal part of the 44kDa lipoprotein LP44 of Mycoplasma salivarium. Stimulator of TLR2/TLR6. Inducer of TNF-alpha production in macrophages. Upregulates proinflammatory cytokines. Activator of the proinflammatory transcription factor NF-kappaB.

Supplier: Adipogen

R-FSL-1 (R-Pam2CGDPKHPKSF) is a synthetic lipoprotein that represents the N-terminal part of the 44kDa lipoprotein LP44 of Mycoplasma salivarium. The naturally occurring R-stereoisomer is biologically more active than the S-stereoisomer. Stimulator of TLR2/TLR6. Inducer of TNF-alpha production in macrophages. Upregulates proinflammatory cytokines. Activator of the proinflammatory transcription factor NF-kappaB.

Supplier: Anaspec Inc

A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: SAMPLING SYSTEMS LTD

The UD Sleeve sampler is perfect for small volume powder sampling.

Supplier: VWR International

Fine, micro-point and sharp blades perfect for fine dissection and suture removal applications.

Supplier: VWR International

These high-quality dissecting scissors are primarily used for general and multipurpose cutting, suture removal and dissection applications.

Supplier: VWR International

These high-quality German steel scissors are fine, micro-point with sharp blades that are perfect for fine dissection and suture removal applications.

Supplier: SURGICAL SPECIALTIES CORP MS

Braided silk suture on a spool.

Supplier: Stoelting

Sterile nonabsorbable and absorbable surgical sutures

Supplier: MED DIMENSIONS, LLC

Ready to take your suturing skills to the next level?

Supplier: Healthcare Products

Nonabsorbable, sterile, surgical, monofilament sutures composed of the long-chain, aliphatic polymers nylon 6 and nylon 6,6

Supplier: Sklar

Econo™ Sterile SklarClip Suture Removal Instrument made of Stainless Steel/Plastic.

Supplier: Myco Medical

Reli® Coated PGA Undyed Braided Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Myco Medical

Reli® Plain Gut Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Healthcare Products

Absorbable sterile sutures are made from unique synthetic copolymers that provide unprecedented monofilament pliability and smooth passage through tissue

Supplier: Sklar

The Sklar® Dechamps Ligature Carriers are used for guiding suture material into difficult to reach areas or deep muscle and tissue.

Supplier: Myco Medical

Reli® Polypropylene Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Healthcare Products

Absorbable, sterile surgical sutures are composed of purified connective tissue (mostly collagen) derived from either the serosal layer of bovine intestines or the submucosal fibrous layer of ovine intestines

Supplier: Myco Medical

Reli® Polyester Green Braided Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Myco Medical

Reli® PGA Violet Braided Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Myco Medical

Reli® Monofilament Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort

Supplier: Johnson & Johnson

Nonabsorbable, sterile surgical sutures composed of an isotactic crystalline stereoisomer of polypropylene, a synthetic linear polyolefin

Supplier: Myco Medical

Reli® Black Nylon Sutures feature high quality, high performance needles made from AISI 304 Stainless Steel for improved needle integrity and sharpness, smooth insertion, and patient comfort