136570 Results for: "METTLER TOLEDO RAININ LLS MS"

Supplier: Avantor

Students use several techniques to investigate the location, methods, and mechanisms of transpiration in plants. Students first determine the source of water loss and confirm their findings with a qualitative chemical test. Then they prepare microscope slides of xylem in stem tissue, and prepare a leaf imprint using an innovative method that vividly highlights stomate structures. Finally, using WARD’S specially-designed potometer and supplied materials, students subject bean seedlings to varying environmental conditions to determine how transpiration is affected. You’ll get enough materials for eight setups, a teacher’s guide, and student copymaster.

Supplier: Anaspec Inc

This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and analysis studies.
Sequence: Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
MW: 4832.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: TMW Media Group

How can humans work with the environment?

Supplier: Bioss

Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. Along with the family of proteins known as defensins, cathelicidins participate in the first line of defense by preventing local infection and systemic invasion of microbes. FALL-39 precursor (FALL-39 peptide antibiotic, cationic anti-microbial protein, CAMP, CAP-18, HSD26) is a cathelicidin anti-microbial protein that contains the antibacterial peptide LL-37 (amino acids 134-170). In contrast to the defensins, which are cysteine-rich peptides that fold in ∫-pleated sheets, LL-37 is a cysteine-free peptide that can adopt an amphipathic å-helical conformation. LL-37 binds to bacterial lipopolysaccharides (LPS) and is a potent chemotactic factor for recruiting mast cells to sites of inflammation. LL-37 is present in inflammatory skin diseases that include psoriasis, sub-acute lupus erthematosus, dermatitis and nickel contact hypersensitivity. It is not found in normal skin epidermis. The secreted protein is expressed primarily in bone marrow, testis and neutrophils. The mouse and rat ortholog, CRAMP (cathelin-related antimicrobial peptide), is also part of the cathelicidin family of host defense peptides. These include precursors of potent antimicrobial peptides that direct antimicrobial activity against various microbial pathogens and also activate mesenchymal cells during wound repair. CRAMP is expressed in testis, spleen, stomach and intestine.

Supplier: Bioss

Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. Along with the family of proteins known as defensins, cathelicidins participate in the first line of defense by preventing local infection and systemic invasion of microbes. FALL-39 precursor (FALL-39 peptide antibiotic, cationic anti-microbial protein, CAMP, CAP-18, HSD26) is a cathelicidin anti-microbial protein that contains the antibacterial peptide LL-37 (amino acids 134-170). In contrast to the defensins, which are cysteine-rich peptides that fold in -pleated sheets, LL-37 is a cysteine-free peptide that can adopt an amphipathic å-helical conformation. LL-37 binds to bacterial lipopolysaccharides (LPS) and is a potent chemotactic factor for recruiting mast cells to sites of inflammation. LL-37 is present in inflammatory skin diseases that include psoriasis, sub-acute lupus erthematosus, dermatitis and nickel contact hypersensitivity. It is not found in normal skin epidermis. The secreted protein is expressed primarily in bone marrow, testis and neutrophils. The mouse and rat ortholog, CRAMP (cathelin-related antimicrobial peptide), is also part of the cathelicidin family of host defense peptides. These include precursors of potent antimicrobial peptides that direct antimicrobial activity against various microbial pathogens and also activate mesenchymal cells during wound repair. CRAMP is expressed in testis, spleen, stomach and intestine.

Supplier: Rockland Immunochemical

Cathelicidin (LL-37) Control Peptide

Supplier: Rockland Immunochemical

Cathelicidin (LL-37) Control Peptide

Supplier: Rockland Immunochemical

Cathelicidin (LL-37) Control Peptide

Supplier: Immunoreagents

Llama Ig Ig Fraction , , , , ImmunoReagents Inc. ImmunoReagents# Ll-003-B

Supplier: Ohaus

Designed for a wide range of Legal-for-Trade applications, the Class ll and Class III certified SJX balances are ideal for weighing cannabis, jewellery, precious metals and gemstones.

Supplier: AFG Bioscience

Human Antibacterial Peptide LL 37 (APLL 37) ELISA Kit

Supplier: Avantor

With this Complete Sheep Heart Dissection Lab, you’ll receive: 10 high quality specimens that are easy to pin and dissect, packed in formaldehyde-free Borealene II. 20 student manuals with pre-test, post-test and easy to follow step-by-step instructions. 10 disposable dissection trays that offer direct pinning to the surface with no cleanup or resurfacing. Teacher’s guide with student objectives, teaching hints and answers to student tests. Replacement Student Manuals and Teacher’s Guides may also be purchased separately.

Supplier: Anaspec Inc

This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and activity studies.
Sequence: 5 - FAM - LC - [LL-37, 37 aa]
MW: 4964.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: ROLF C. HAGEN (USA) CORP.

Everything you'll need to recreate a successful marine reef.

Supplier: TMW Media Group

Video support for return to office training.

Supplier: Bioss

Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. Along with the family of proteins known as defensins, cathelicidins participate in the first line of defense by preventing local infection and systemic invasion of microbes. FALL-39 precursor (FALL-39 peptide antibiotic, cationic anti-microbial protein, CAMP, CAP-18, HSD26) is a cathelicidin anti-microbial protein that contains the antibacterial peptide LL-37 (amino acids 134-170). In contrast to the defensins, which are cysteine-rich peptides that fold in ∫-pleated sheets, LL-37 is a cysteine-free peptide that can adopt an amphipathic å-helical conformation. LL-37 binds to bacterial lipopolysaccharides (LPS) and is a potent chemotactic factor for recruiting mast cells to sites of inflammation. LL-37 is present in inflammatory skin diseases that include psoriasis, sub-acute lupus erthematosus, dermatitis and nickel contact hypersensitivity. It is not found in normal skin epidermis. The secreted protein is expressed primarily in bone marrow, testis and neutrophils. The mouse and rat ortholog, CRAMP (cathelin-related antimicrobial peptide), is also part of the cathelicidin family of host defense peptides. These include precursors of potent antimicrobial peptides that direct antimicrobial activity against various microbial pathogens and also activate mesenchymal cells during wound repair. CRAMP is expressed in testis, spleen, stomach and intestine.

Supplier: Bioss

Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. Along with the family of proteins known as defensins, cathelicidins participate in the first line of defense by preventing local infection and systemic invasion of microbes. FALL-39 precursor (FALL-39 peptide antibiotic, cationic anti-microbial protein, CAMP, CAP-18, HSD26) is a cathelicidin anti-microbial protein that contains the antibacterial peptide LL-37 (amino acids 134-170). In contrast to the defensins, which are cysteine-rich peptides that fold in ∫-pleated sheets, LL-37 is a cysteine-free peptide that can adopt an amphipathic å-helical conformation. LL-37 binds to bacterial lipopolysaccharides (LPS) and is a potent chemotactic factor for recruiting mast cells to sites of inflammation. LL-37 is present in inflammatory skin diseases that include psoriasis, sub-acute lupus erthematosus, dermatitis and nickel contact hypersensitivity. It is not found in normal skin epidermis. The secreted protein is expressed primarily in bone marrow, testis and neutrophils. The mouse and rat ortholog, CRAMP (cathelin-related antimicrobial peptide), is also part of the cathelicidin family of host defense peptides. These include precursors of potent antimicrobial peptides that direct antimicrobial activity against various microbial pathogens and also activate mesenchymal cells during wound repair. CRAMP is expressed in testis, spleen, stomach and intestine.

Supplier: Bioss

Cathelicidins are a family of antimicrobial proteins found in the peroxidase-negative granules of neutrophils. Along with the family of proteins known as defensins, cathelicidins participate in the first line of defense by preventing local infection and systemic invasion of microbes. FALL-39 precursor (FALL-39 peptide antibiotic, cationic anti-microbial protein, CAMP, CAP-18, HSD26) is a cathelicidin anti-microbial protein that contains the antibacterial peptide LL-37 (amino acids 134-170). In contrast to the defensins, which are cysteine-rich peptides that fold in ∫-pleated sheets, LL-37 is a cysteine-free peptide that can adopt an amphipathic å-helical conformation. LL-37 binds to bacterial lipopolysaccharides (LPS) and is a potent chemotactic factor for recruiting mast cells to sites of inflammation. LL-37 is present in inflammatory skin diseases that include psoriasis, sub-acute lupus erthematosus, dermatitis and nickel contact hypersensitivity. It is not found in normal skin epidermis. The secreted protein is expressed primarily in bone marrow, testis and neutrophils. The mouse and rat ortholog, CRAMP (cathelin-related antimicrobial peptide), is also part of the cathelicidin family of host defense peptides. These include precursors of potent antimicrobial peptides that direct antimicrobial activity against various microbial pathogens and also activate mesenchymal cells during wound repair. CRAMP is expressed in testis, spleen, stomach and intestine.

Supplier: Janitorial Supplies

You'll be happy to have this Brute® on your side.

Supplier: Restek

Interchangeable barrels, plungers, and tips extend performance and increase cost-effectiveness.

Supplier: Immunoreagents

Protein G Purified , , , , ImmunoReagents Inc. ImmunoReagents# Ll-003-Z

Supplier: Bel-Art

Attach this compact unit to a liquid CO2 cylinder and in a few minutes you’ll have a ready-to-use 250 - 350 g block of dry ice.

Supplier: DWK Life Sciences (KIMBLE)

Manifold, 8-channel, LL

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.

Supplier: Brady Worldwide

Seamlessly connect the Brady® products you rely on with a printer and scanner system. Powered by smart technology and intuitive software solutions, you’ll have the advanced tools you need to optimize operations.