"Boster Biological Technology"

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Cystatin-B(CSTB) detection. Tested with WB, IHC-P in Human.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1(GNB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

Supplier: Boster Biological Technology

Sandwich ELISA kit of Quantitative Detection for Human CEA

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for ICAM2 detection. Tested with WB, Direct ELISA in Human;Rat.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Prolactin regulatory element-binding protein(PREB) detection. Tested with WB in Human.

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Supplier: Boster Biological Technology

Polyclonal antibody for Chymase/CMA1 detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. Chymase/CMA1 information: Molecular Weight: 27325 MW; Subcellular Localization: Secreted. Cytoplasmic granule. Mast cell granules; Tissue Specificity: Mast cells in lung, heart, skin and placenta. Expressed in both normal skin and in urticaria pigmentosa lesions.

Supplier: Boster Biological Technology

A ELISA kit containing the core components for developing solid phase sandwich ELISA assay to quantitatively detects NGF/NGF beta in Human samples

Supplier: Boster Biological Technology

HnRNP D/AUF1/HNRNPD Monoclonal Antibody, Clone: 4F3, Host: Mouse, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived human hnRNP D/AUF1/HNRNPD recombinant protein (Position: E88-N246), Alternative Names: AUF1, AUF1A, Size: 100ug/vial

Supplier: Boster Biological Technology

Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Bovine TGF beta 1

Supplier: Boster Biological Technology

Sandwich ELISA kit of Quantitative Detection for Human Renin

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for liver FABP detection. Tested with WB, Direct ELISA in Mouse;Rat.

Supplier: Boster Biological Technology

BMP5 Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Isotype: IgG, Conjugate: DyLight* 488, Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL) Alternative Names: BMP-5, BMP5, Size: 50ug/vial

Supplier: Boster Biological Technology

Rabbit IgG polyclonal antibody for Exportin-5(XPO5) detection. Tested with WB in Human;Mouse;Rat.