"Anaspec"

Supplier: Anaspec

This is amino acids 25 to 35 fragment of beta-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm.
Sequence: HiLyte™ Fluor 488-GSNKGAIIGLM
Molecular Weight: 1416.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

This peptide, Exendin-4, has a biotin on the N-terminus. Exendin-4, an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: Biotin-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4412.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.

Supplier: Anaspec

This is beta-amyloid (10-35) with a Lys added on the C-terminus, biotin is attached to the side chain of this Lys.
Sequence: YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
Molecular Weight: 3256.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Supplier: Anaspec

The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec

Fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Supplier: Anaspec

HiLyte™ Fluor 532 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye.

Supplier: Anaspec

This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-40) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-40) (Aβ40) amount in cell and tissue lysate as well as in body fluids

Supplier: Anaspec

The SensoLyte® Green Elastase Assay Kit is a FRET-based assay that detects elastase activity. The kit provides an elastin, natural substrate for elastases, labeled with 5-FAM fluorophore and QXL®520 quencher. Elastase-catalyzed hydrolysis yields brightly green fluorescence. Increase in fluorescence intensity is directly proportional to enzyme activity. The kit does not require any separation steps and can be used to continuously measure the kinetics of elastase.

Supplier: Anaspec

This peptide is a histone H3 trimethylated at lysine 4 and is associated with transcription, specifically marking the transcription start site of actively transcribed genes. This peptide can be demethylated by Jumonji AT-rich interactive domanin 1 (JARID1) or by lysine demethylase 5 (KDM5) family of lysine demethylases.
Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA
MW: 2296.6 Da
% peak area by HPLC: 95
Storage condition: -20 °C

Supplier: Anaspec

Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.

Supplier: Anaspec

This kit is optimized to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA. The amount of anti-human MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Mouse anti-human MOG IgG standard is included. Ample materials and reagents are provided to perform 96 assays in a 96-well plate format.

Supplier: Anaspec

CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Penetratin-Arg is the same as Penetratin except that Lysine residues were substituted with Arginines. It forms an alpha-helix structure in lipid environment and can permeate cell membrane at low micromolar concentration without significantly affecting membrane. CPP can be conjugated with large molecules and used as a drug delivery vehicle. R
Sequence:RQIRIWFQNRRMRWRR
MW:2358.8 Da
% peak area by HPLC:95
Storage condition:-20° C