"Anaspec"

Supplier: Anaspec

H3K69 methylation is generally associated with transcriptional activation, with methylation catalyzed by DOT/DOT1L enzyme in the context of a nucleosome. Aberrant methylation of H3K79 has been implicated in leukemias. Histone H3 (69-89) peptides are used for assessing the specificity of anti-H3K79me antibodies.
Sequence:RLVREIAQDFKTDLRFQSSAV-NH2
MW:2479 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Prion protein (PrP), also known as CD230, is mainly produced in the nervous sytem. PrP exists as different isoforms, among which the normal PrPc, and the 'scrapie' isoform PrPSc. PrPSc is misfolded and associated to multiple disorders including bovine spongiform encephalopathy, Gerstmann-Straüssler-Scheindker disease (GSS) and the Creutzfeldt-Jakob disease. It contains a much higher beta-sheet content than PrPc, and tends to form protease-resistant aggregates. A hypothesis to support the propoagation of these aggregates and their role in neurodegeneration is that the change from normal PrPc is due to its interaction with PrPSc 'conformation conversion hypothesis).
PrP 127-147 forms filamentous structures ressembling scrapie-associated fibrils, but possesses a lower amyloidogenic potential than PrP 106-126.
Sequence:KTNMKHMAGAAAAGAVVGGLG
MW:1912.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Supplier: Anaspec

The absorption spectrum of DABCYL Plus™ is environment-sensitive as in the case of DABCYL dyes. For example, in water, the spectrum of DABCYL Plus™ is red-shifted ca. 40 nm compared to that in methanol.

Supplier: Anaspec

Calcein, AM is a cell-permeant and non-fluorescent compound that is widely used for determining cell viability

Supplier: Anaspec

Caerulein, a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary, and pancreatic secretion. Caerulein injections cause acute pancreatitis in mice.
Sequence: Pyr-QD-Y(SO3H)-TGWMDF-NH2
MW: 1352.4 Da
% Peak area by HPLC: 95
Storage condition:

Supplier: Anaspec

The native peptide, HATPPKKKRK (cat# 60522-1), is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1). The fluorescent and biotinylated peptides are used to develop assays for CDK1.
Sequence:HATPPKKKRK
MW:1190.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cell-permeant DNA minor groove binding dye

Supplier: Anaspec

This 15-mer peptide is fragment of (CFP)10 protein, which is secreted from mycobacterium tuberculosis 10-kDa culture filtrate stimulate IFN-gamma; production and CTL activity by CD4+ and CD8+ cells, from persons expressing a spectrum of MHC molecules. This peptide is an excellent candidate for inclusion in a subunit antituberculosis vaccine.
Sequence:EISTNIRQAGVQYSR
MW:1721.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This Ghrelin peptide is biotinylated at the peptide N-terminus. Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: Biotin-GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3597.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec

Protection activity of humanin (HN) against neuronal cell death is abrogated in this peptide, where Cys8 is substituted by Ala.
Sequence:MAPRGFSALLLLTSEIDLPVKRRA
MW:2655.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

CGRP is a 37-amino acid neuropeptide produced by tissue specific processing of the calcitonin gene and is the major product in neural tissues.
Sequence:ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge: 2-7)
MW:3789.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

Dynorphins are a class of opioid peptides that arise from the precursor protein prodynorphin. Upon cleavage by proprotein convertase 2 (PC2), multiple active peptides are released: dynorphin A, dynorphin B, and α/β-neo-endorphin. Dynorphins exert their effects primarily through the κ-opioid receptor (KOR), a G-protein-coupled receptor. Dynorphin has been shown to be a modulator of pain response, involved in drug addiction and appetite control.
Sequence:YGGFLRRI
MW:981.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Cathepsin B is a member

Supplier: Anaspec

This is amino acids 1 to 42 beta-amyloid with the England mutation where His6 is replaced by Arg6. This novel familial Alzheimer’s disease (FAD) -linked APP mutation accelerates the fibril elongation rate without a concomitant increase in the levels of protofibrils. The proband in the English family was diagnosed at 55 years of age.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
MW: 4533.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C