Order Entry
United States
ContactUsLinkComponent
4989 results for "Anaspec Inc"

4989 Results for: "Anaspec Inc"

Sort By

GRGDS, Amide

Supplier: Anaspec Inc

This peptide inhibits the adhesion of human ovarian carcinoma OVCAR-3 cells to fibronectin, but not to laminin.
Sequence:GRGDS-NH2
MW:489.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® 520 MMP-12 Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

SensoLyte® 520 Neprilysin Activity Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues

Expand 1 Items
Loading...

Staphylococcus aureus Recombinant Protein A (from E. coli), Biotin

Supplier: Anaspec Inc

This is biotinylated Protein A conjugate suitable for asssay development, IHC, IF, immunoprecipitation or western blotting.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Expand 1 Items
Loading...

Cyclin-dependent kinase 5 peptide

Supplier: Anaspec Inc

The native peptide PKTPKKAKKL (60026-1) is derived from histone H1 peptide sequence that is docked in the active site of cyclin-dependent kinase 5. It is an effective CDK5 substrate (Km = 40 µM).
Sequence:PKTPKKAKKL
MW:1138.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Fibrinogen Binding Inhibitor Peptide

Supplier: Anaspec Inc

The fibrinogen binding inhibitor peptide is important for platelet aggregation. The sequence is derived from the carboxy terminus of the gamma chain of fibrinogen (residues 400-411). This is considered one of the common ligands for glycoprotein (GPIIb-IIIa) recognition and binding.
Sequence:HHLGGAKQAGDV
MW:1189.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human Galanin

Supplier: Anaspec Inc

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Recombinant MOG (1-125) (from E. coli)

Supplier: Anaspec Inc

Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # CAQ10087) corresponding to the extracellular domain of human MOG along with a 6x His tag was expressed in E. coli. The recombinant human MOG (H-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant human MOG is 14.2 kDa

Expand 3 Items
Loading...

Bim BH3, Peptide IV

Supplier: Anaspec Inc

This Bim peptide belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
Sequence:DMRPEIWIAQELRRIGDEFNAYYARR
MW:3269.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Bovine Rhodopsin Epitope Tag

Supplier: Anaspec Inc

This is a 9-amino acid peptide corresponding to the C-terminus of bovine rhodopsin. It is widely used as an epitope tag. A number of anti-rhodopsin antibodies recognize this epitope.
Sequence:TETSQVAPA
MW:903 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Histone H1-derived Peptide

Supplier: Anaspec Inc

Histone H1-derived peptide, phosphorylated by protein kinase A, is a substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA.
Sequence:GGGPATPKKAKKL
MW:1252.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Aquaporin-2 (254-267), pSER261

Supplier: Anaspec Inc

This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. Protein phosphorylation plays a key role in vasopressin signaling in renal-collecting duct. Phosphorylation at several AQP2 residues including Ser256 and Ser261, is altered in response to vasopressin. It is possible that both sites are involved in vasopressin-dependent AQP2 trafficking.
Sequence: RQSVELH-pS-PQSLPR
MW: 1713.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

West Nile Virus Recombinant WNV NS3 Protease (from E. coli)

Supplier: Anaspec Inc

West Nile virus (WNV) is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus (Den), Japanese Encephalitits virus (JE), and Yellow Fever virus (YF). WNV is a small, enveloped virus with a single stranded, positive sense 11kb RNA genome, which encodes a polyprotein precursor. This polyprotein must be cleaved co- and post-translationally to produce ten functional proteins: three structural (C, prM and E) and 7 nonstructural (NS1, NS2A, NS2B, NS3, NS4A,NS4B and NS5). WNV NS3 protease is absolutely essential (along with viral-encoded cofactor NS2B) for post-translational cleavage and viral replication. As a result, this protease is a potential therapeutic target.

His-tagged recombinant WNV NS3 protease (residues 1 to 184) was expressed as a fusion protein with the cofactor NS2b (residues 49 to 96) and a linker sequence (GGGGSGGGG) in E. coli. The apparent Mr on SDS-PAGE is 32-kDa. Its activity can be measured by FRET peptides

Expand 2 Items
Loading...

Human [Met]-beta-Amyloid (1-42), TAMRA (5-Carboxytetramethylrhodamin)

Supplier: Anaspec Inc

This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 1 Items
Loading...

CKS-17 (dimer)

Supplier: Anaspec Inc

A dimer of CKS-17 has a natural occurring cysteine at the carboxyl terminus (where it occurs in the retroviral peptides on which CKS-17 is based) and dimerization is accomplished by cysteine-disulfide linkage. CKS-17 is a synthetic retroviral envelope heptadecapeptide corresponding to a region highly conserved in retroviral transmembrane proteins such as pl5E. The CKS-17 peptide has been previously shown to inhibit monocyte superoxide production, natural killer cell activity, polyclonal B-cell activation, and monocyte-mediated killing by inactivation of interleukin-1.
Sequence:LQNRRGLDLLFLKEGGLC (dimer)
MW:4088.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

E alpha (52–68)

Supplier: Anaspec Inc

This peptide is MHC class II antigen E alpha
Sequence:ASFEAQGALANIAVDKA
MW:1675.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Bacterial Sortase Substrate I

Supplier: Anaspec Inc

This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® 520 Thrombin Activity Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Thrombin, a serine protease, plays a central role in hemostasis by converting soluble plasma fibrinogen into an insoluble fibrin clot and by promoting platelet aggregation

Expand 1 Items
Loading...

Bovine;Human;Mouse;Rat Orexin A

Supplier: Anaspec Inc

This hypothalamic neuropeptide has been shown to regulate feeding behavior.
Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
MW:3561.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Dihydroethidium

Supplier: Anaspec Inc

Bind to DNA/RNA (red fluorescence) upon oxidation. Store at -20C desiccated and protected from light

Expand 1 Items
Loading...

Human Beta-Amyloid (1-37)

Supplier: Anaspec Inc

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
Loading...

Human Lactoferricin H

Supplier: Anaspec Inc

This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.
Sequence:TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
MW:3019.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Hen Elafin

Supplier: Anaspec Inc

This is a fragment of the elafin (elastase-specific inhibitor), an antiproteinase and antimicrobial (gram-positive and gram-negative respiratory pathogens) molecule that is expressed at epithelial sites. Elafin is a potent inhibitor of HNE and proteinase 3 produced in the skin, and in the airways , which is up-regulated in response to early inflammatory cytokines such as TNF and IL-1. Elafin, along with SLPI, also shares characteristics with antimicrobial defensin-like molecules in being a low molecular weight cationic peptide with the ability to eliminate pulmonary pathogens.
Sequence:AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53)
MW:5999.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Alpha9-Gliadin (57-68)

Supplier: Anaspec Inc

Gliadin is a gluten component. This peptide is derived from amino acid residues 57-68 of a9-gliadin and represents an immunodominant epitope that has been shown to elicit HLA-DQ2-restricted T-cell responses in celiac patients. This epitope is resistant to pancreatic proteolysis.
Sequence: QLQPFPQPQLPY
MW: 1455.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

O-linked GlcNAc transferase (OGT) Substrate

Supplier: Anaspec Inc

A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.
Sequence:KKKYPGGSTPVSSANMM
MW:1783.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® 520 MMP-3 Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

5(6)-Carboxyfluorescein

Supplier: Anaspec Inc

Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Expand 4 Items
Loading...

[Lys(Me2)27]-Histone H3 (23-34)

Supplier: Anaspec Inc

This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Glucagon-Like Peptide 1, GLP-1 (7-37)

Supplier: Anaspec Inc

GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Chicken OVA (323-339), FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc

This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...
Sort By
Recommended for You