Order Entry
United States
ContactUsLinkComponent
 

4989 Results for: "Anaspec Inc"

HIV Substrate, QXL® 520-HiLyte Fluor™ 488

Supplier: Anaspec Inc

This fluorogenic HIV-1 protease substrate contains the FRET pair HiLyte488 (fluorophore) and QXL520 (quencher), and a γ-Abu spacer. This FRET substrate is cleaved by the HIV-1 protease to generate fuorescence (Ex = 490nm; Em = 520nm).
Sequence:QXL™520-GABA-SQNYPIVQ-K(HiLyte Fluor™ 488)-NH2
MW:2008.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Src Optimal Peptide Substrate

Supplier: Anaspec Inc

The synthetic peptide has been identified as a Src optimal peptide substrate. It may be used to measure the wild type Src activity in comparison with other family members.
Sequence:AEEEIYGEFEAKKKK
MW:1799 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Bovine;Human;Pig Glucagon (1-29)

Supplier: Anaspec Inc

Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycemia.
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3482.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Human ACTH (1-10)

Supplier: Anaspec Inc

Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits.
Sequence: SYSMEHFRWG
MW: 1299.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Mouse;Rat Beta-Amyloid (1-42)

Supplier: Anaspec Inc

This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Expand 2 Items
Loading...

Human Angiotensin II Substrate

Supplier: Anaspec Inc

This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Hepatitis virus HCV Protease Substrate, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

A highly sensitive FRET substrate for assaying HCV (Hepatitis C Virus) NS3/4A protease activity. It detects < 0.1pmol of HCV NS3/4A protease. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 490/512 nm.
Sequence:Ac-DE-Dap(QXL520)-EE-Abu-ψ;-[COO]AS-C(5-FAMsp)-NH2
MW:1913.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human Peptide Myelin Oligodendrocyte Glycoprotein, AnaSpec

Supplier: Anaspec Inc

This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Histone H3 (1-25)

Supplier: Anaspec Inc

This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Chicken OVA (323-339), TAMRA (5-Carboxytetramethylrhodamin)

Supplier: Anaspec Inc

This is a class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class II MHC molecule, H-2Kb. It is fluorescently labeled with 5-TAMRA, Abs/Em = 541/565 nm.
Sequence: 5-TAMRA-ISQAVHAAHAEINEAGR
MW: 2186.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Expand 1 Items
Loading...

Human GIP (1-42)

Supplier: Anaspec Inc

GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4983.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 2 Items
Loading...

Human PLP

Supplier: Anaspec Inc

This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

HIV TAT (47-57) GGG-Cys(Npys)

Supplier: Anaspec Inc

This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. The N-terminus is rendered free for applications requiring certain conjugation reactions with a free N-terminal end, and a linker GGG is placed at the C-terminal end, and the peptide has been synthesized with the C(Npys) group. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: YGRKKRRQRRRGGG-C(Npys)-NH2
MW: 1987.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Expand 1 Items
Loading...

Bovine Bactenecin

Supplier: Anaspec Inc

Bactenecin is a 12-amino acid cationic antimicrobial peptide from bovine neutrophils.
Sequence:RLCRIVVIRVCR (Disulfide bridge: 3-11)
MW:1483.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Cys(Npys)-(D-Arg)9

Supplier: Anaspec Inc

(Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:C(Npys)rrrrrrrrr-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

Human [Des-octanoyl]-Ghrelin

Supplier: Anaspec Inc

Des-octanoyl (or Des-acyl) Ghrelin, DAG, is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPR
MW: 3244.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Expand 1 Items
Loading...

Bid BH3 Peptide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc

This is a 5-FAM-labeled Bid BH3 peptide. Bid is a pro-apoptotic member of the 'BH3-only' subset of the BCL-2 family proteins that constitute a critical control point in apoptosis. Bid interconnects extrinsic pathway TNFR1 and Fas death signals to the mitochondrial amplification of the intrinsic pathway. The references listed below belong to the unlabeled Bid BH3.
Sequence:5-FAM-EDIIRNIARHLAQVGDSMDR
MW:2667.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Expand 1 Items
Loading...

SensoLyte® 520 Thiol Quantitation Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.

Expand 1 Items
Loading...

SensoLyte® MUG β-Galactosidase Assay Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

β-galactosidase, encoded by the lacZ gene in E

Expand 1 Items
Loading...

SensoLyte® GST Activity Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

GST (Glutathione S-Transferase) enzymes, a family of isozymes plays a crucial role in body defense mechanisms against toxins and carcinogens

Expand 1 Items
Loading...

SensoLyte® Total GSH Assay Kit (Colorimetric), AnaSpec

Supplier: Anaspec Inc

Glutathione (GSH) is an important antioxidant molecule that functions as a cofactor for a variety of enzymes and is involved in various biological processes

Expand 1 Items
Loading...

SMCC Activated B - PE

Supplier: Anaspec Inc

B-Phycoerythrin (B-PE), a fluorescent protein from phycobiliprotein family, is isolated from cyanobacteria and eukaryotic algae. SMCC activated B-PE is chemically modified with SMCC. SMCC reacts with the primary amine on B-PE and introduces maleimide groups to B-PE. These maleimide groups easily react with thiol groups of target protein without the need for any additional activation, resulting in convenient conjugation of B-PE with proteins. Its primary absorption peak is at 545 nm with secondary peak at 563 nm. B-PE and the closely related R-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. B-PE conjugates have been widely used in applications such as flow cytometry and multi-color immunofluorescent staining.

Expand 1 Items
Loading...

SensoLyte® 520 MMP Profiling Kit (Fluorimetric), AnaSpec

Supplier: Anaspec Inc

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Expand 1 Items
Loading...

1,1'-Di-n-octadecyl-3,3,3',3'-tetramethylindocarbocyanine iodide fluorescent dye

Supplier: Anaspec Inc

A lipophilic membrane stain that diffuses laterally to stain the entire cell; Its fluorescence is significantly enhanced upon membrane incorporation.

Expand 1 Items
Loading...

SensoLyte® 490 MMP-1 Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

MMP-1 (interstitial collagenase, fibroblast collagenase) is an extracellular protease

Expand 1 Items
Loading...

SensoLyte® 490 HIV Protease Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

HIV protease (PR) is identified as an important drug-screening target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics.

Expand 1 Items
Loading...

SensoLyte® 490 HCV Protease Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

HCV protease is identified as an important drug-screening target.

Expand 1 Items
Loading...

SensoLyte® ADHP Hydrogen Peroxide Assay Kit (Fluorimetric), AnaSpec Inc.

Supplier: Anaspec Inc

Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.

Expand 1 Items
Loading...

5-Carboxyfluorescein-N-succinimidyl ester (5-FAM SE)

Supplier: Anaspec Inc

5-FAM, SE is a single isomer. It is one of the most popular green fluorescent reagents used for labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Expand 2 Items
Loading...

5(6)-Carboxy-X-rhodamine

Supplier: Anaspec Inc

ROX dyes have longer excitation and emission wavelengths than the other ‘conventional’ rhodamines. These dyes are used to label peptides, proteins, and other biological ligands. 5-ROX, 6-ROX and their mixture 5(6)-ROX are used to label biomolecules by EDC-mediated reactions.

Expand 1 Items
Loading...
Recommended for You