"Anaspec"

Supplier: Anaspec

The SensoLyte® 520 Acetylcholinesterase Assay Kit is a homogeneous assay that can be used to detect the activity of enzyme and for screening of AChE inhibitors

Supplier: Anaspec

This gelatin is heavily labeled with FITC, and the conjugate is a highly quenched gelatinase/collagenase substrate. It is efficiently digested by gelatinases and collagenases, releasing brightly fluorescent peptides. The increase in fluorescence upon digestion is proportional to proteolytic activity. Longer incubation may increase its sensitivity for detecting proteases.

Supplier: Anaspec

Hoe 140 is a stable B2 bradykinin antagonist. Based on its high potency and good tolerability, Hoe 140 is used to evaluate the role of bradykinin in human diseases.
Sequence:rRP-(Hyp)-G-(Thi)-S-(D-Tic)-(Oic)-R
MW:1304.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec

This peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM).
Sequence:GRSRSRSRSR
MW:1204.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide is beta-amyloid N-terminally truncated to obtain 5-42 peptide.
Sequence: RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4051.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

(Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: GSNKGAIIGLM - HCl
Molecular Weight: 1060.3+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

The unlabeled phosphopeptide is an excellent substrate for mammalian protein tyrosine phosphatase 1B (Km = 3.9 µM) and Yersinia PTP. The sequence is derived from an autophosphorylation site (Tyr992) of EGFR. The unlabeled peptide is used to assay PTB based on marked fluorescence increase upon the removal of the phosphate group (Em = 305 nm and Ex = 282 nm).
Sequence:Biotin-DADE-pY-LIPQQG
MW:1556.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec

Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Supplier: Anaspec

Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the dutch mutant, Glu 22 is replaced with Gln, leading to rapid formation of neuroteoxic aggregates with higher proteolysis resistance.
Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec

The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed through cleavage of Ang I by the angiotensin-conve
Sequence: DRVY-I*-HPF [I*= I(U13C6,15N)]
MW: 1053.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec

This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C