Human Recombinant CXCL10 (IP-10) (from E. coli)
Recombinant Human CXCL10 (IP-10) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
CXCL10 (IP-10) was originally identified as an IFN-gamma-inducible gene in endothelial, fibroblasts and monocytes cells. IP-10 is considered a member of the CXC chemokine subfamily from its protein sequence which includes the four conserved cysteine residues present in CXC chemokines. IP-10 signals through the CXCR3 receptor to selectively attract Th1 lymphocytes and monocytes. It also has angiostatic and mitogenic properties on vascular smooth muscle cells. A diverse population of cell types rapidly increases transcription of mRNA encoding IP-10, which suggests that gamma-induced protein may be a key mediator of the IFNG/IFN-gamma response.
: Larger sizes available, please request a custom quote.
: Shipped lyophilized at room temperature.
: For research use only, not for use in humans.
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Storage Conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin Content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological Activity:EC50 = 6.3 nM determined by Migration Assay in cells expressing recombinant CXCR3
- Gene ID:Accession # P02778 (22-98)
- Reconstitution Instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-Free:Y
- Protease-free:Y
- Protein Synonyms:C7|IFI10|INP10|IP-10|crg-2|mob-1|SCYB10|gIP-10
- Protein/Peptide Name:CXCL10 (IP-10)
- Purity:>97%
- Molecular Weight:8.65 kDa
- Sequence:VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Endotoxin Level:Very low
- Formulation:Lyophilized pellet
- Shipping Temperature:RT
- Tested Applications:Migration assay
Frequently Bought Together