Human Recombinant CCL5 (Rantes) (from E. coli)
Supplier: CHEMOTACTICS, INC MS
Certificates
About this item
Recombinant Human CCL5 (Rantes) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
Regulated on Activation, Normal T cell Expressed and Secreted (RANTES) (CCL5) is a proinflammatory chemokine that induces migration and activation of leukocytes, as well as implication in HIV infection. It binds to cell surface receptors CCR1, CCR3, CCR4, and CCR5. Its biological effects on leukocyte activation and HIV infection displays dependence on concentration and on the binding of cell surface glycosaminoglycans.
Ordering information: Larger sizes available, please request a custom quote.
Delivery: Shipped lyophilized at room temperature.
Caution: For research use only, not for use in humans.
Specifications
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Storage Conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin Content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological Activity:EC50 = 0.13 nM determined by Migration Assay in cells expressing recombinant CCR5
- Gene ID:Accession # P13501 (24-91)
- Reconstitution Instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-Free:Y
- Protease-free:Y
- Protein Synonyms:D17S136E|RANTES|SCYA5|SIS-delta|SISd|TCP228|eoCP
- Protein/Peptide Name:CCL5 (Rantes)
- Purity:>97%
- Molecular Weight:7.85 kDa
- Sequence:SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
- Endotoxin Level:Very low
- Formulation:Lyophilized pellet
- Shipping Temperature:RT
- Tested Applications:Migration assay
Specifications
Frequently Bought Together