Human Recombinant CCL3 (MIP-1a) (from E. coli)
Supplier: CHEMOTACTICS, INC MS
Certificates
About this item
Recombinant Human CCL3 (MIP-1a) in lyopholized format with very low endotoxin levels.
- Extremely low endotoxin levels (<0.01 EU per 1 μg) Functional activity tested and validated For use in various streptavidin applications: Flow cytometry, microscopy, and other imaging techniques
Macrophage inflammatory proteins 1-α (MIP1α)(CCL3) binds to cell surface receptors CCR1 and CCR5. It is proinflammatory, leading to chemotaxis and activation of immune cells. It also inhibits proliferation of hematopoietic stem cells. Moreover, by binding to one of the HIV coreceptors, CCR5, it suppresses HIV infection.
Ordering information: Larger sizes available, please request a custom quote.
Delivery: Shipped lyophilized at room temperature.
Caution: For research use only, not for use in humans.
Specifications
- Conjugation:Unconjugated
- Protein Function:Chemokine
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Storage Conditions:Avoid repeated freeze-thaw cycles 12 months from date of receipt, –20...–70 °C as supplied. 1 month, 2...8 °C under sterile conditions after reconstitution. 3 months, –20...–70 °C under sterile conditions after reconstitution.
- Endotoxin Content:<0.01 EU per 1 μg of the protein by the LAL method
- Biological Activity:EC50 = 0.2 nM determined by Migration Assay in cells expressing recombinant CCR5
- Gene ID:Accession # P10147 (24-92)
- Reconstitution Instructions:Spin sample prior to reconstitution. Recommended concentration of 100 μg/ml in sterile water.
- Endotoxin-free:Y
- Carrier-Free:Y
- Protease-free:Y
- Protein Synonyms:G0S19-1|LD78|LD78ALPHA|MIP-1-alpha|MIP1A|SCI|SCYA3
- Protein/Peptide Name:CCL3 (MIP-1a)
- Purity:>97%
- Molecular Weight:7.72 kDa
- Sequence:SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
- Endotoxin Level:Very low
- Formulation:Lyophilized pellet
- Shipping Temperature:RT
- Tested Applications:Migration assay
Specifications
Frequently Bought Together