Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:WD Repeat Domain 63
- Antigen Symbol:WDR63
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:126820
- Antigen Synonyms:RP11-507C22.2|testis development protein NYD-SP29 (NYD-SP29)|WD repeat-containing protein 63|FLJ30067|Testis development protein NYD-SP29|NYD-SP29|WD repeat domain 63
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to WDR63(WD repeat domain 63) The peptide sequence was selected from the middle region of WDR63. Peptide sequence EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK.
- Purification:Immunogen affinity purified
- Cat. No.:102188-356
- Supplier no.:NBP1-56718
Specifications
About this item
The WDR63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR63. This antibody reacts with human. The WDR63 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: WDR63
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human