Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Tetraspanin 6
- Antigen Symbol:TSPAN6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:7105
- Antigen Synonyms:TM4SF6tetraspan TM4SF|TSPAN-6|Tetraspanin TM4-D|Transmembrane 4 superfamily member 6A15 homolog|tetraspanin 6|T245|Putative NF-kappa-B-activating protein 321|T245 protein|tetraspanin-6
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to TSPAN6(tetraspanin 6) The peptide sequence was selected from the N terminal of TSPAN6. Peptide sequence VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA.
- Purification:Immunogen affinity purified
- Cat. No.:102191-808
- Supplier no.:NBP1-59047
Specifications
About this item
The TSPAN6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSPAN6. This antibody reacts with human. The TSPAN6 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: TSPAN6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human