Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:Surfactant Protein B
- Antigen Symbol:SP-B
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:6439
- Antigen Synonyms:pulmonary-associated protein B|SMDP1|PSP-B|6 kDa protein|18 kDa pulmonary-surfactant protein|Pulmonary surfactant-associated proteolipid SPL(Phe)|SP-B surfactant|surfactant protein B|SFTP3|pulmonary surfactant-associated protein B|SFTB3
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to SFTPB(surfactant, pulmonary-associated protein B) The peptide sequence was selected from the middle region of SFTPB. Peptide sequence PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV.
- Purification:Immunogen affinity purified
- Cat. No.:102190-652
- Supplier no.:NBP1-57977
The SP-B / Surfactant Protein B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SP-B / Surfactant Protein B. This antibody reacts with human. The SP-B / Surfactant Protein B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry.
Type: Primary
Antigen: SP-B
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human