To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:Synovial sarcoma, X breakpoint 2
- Antigen Symbol:SSX2IP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:117178
- Antigen Synonyms:MGC75026|ADIP|Afadin DIL domain-interacting protein|afadin- and alpha-actinin-binding protein|X breakpoint 2 interacting protein|synovial sarcoma|SSX2-interacting protein|FLJ10848|KIAA0923
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to SSX2IP(synovial sarcoma, X breakpoint 2 interacting protein) The peptide sequence was selected from the middle region of SSX2IP. Peptide sequence KVHLEGFNDEDVISRQDHEQETEKLELEIQQCKEMIKTQQQLLQQQLATA.
- Purification:Immunogen affinity purified
- Cat. No.:102191-934
- Supplier no.:NBP1-59113
Specifications
About this item
The SSX2IP Antibody from Novus Biologicals is a rabbit polyclonal antibody to SSX2IP. This antibody reacts with human. The SSX2IP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SSX2IP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human