Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:Ring Finger Protein 170
- Antigen Symbol:RNF170
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:81790
- Antigen Synonyms:Putative LAG1-interacting protein|DKFZP564A022|FLJ38306|ring finger protein 170
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the middle region of RNF170. Peptide sequence CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY.
- Purification:Immunogen affinity purified
- Cat. No.:102193-204
- Supplier no.:NBP1-59759
The RNF170 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF170. This antibody reacts with human. The RNF170 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: RNF170
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human