Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Symbol:RBED1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:84173
- Antigen Synonyms:RBED1|ELMO/CED-12 domain containing 3|RNA-binding protein 29|RNA-binding motif and ELMO domain-containing protein 1|FLJ21977|FLJ35601|RNA binding motif and ELMO/CED-12 domain 1|ELMO domain-containing protein 3|liver-specific organic anion transporter 3TM12|RNA-binding motif protein 29|organic anion transporter LST-3b|RNA binding motif and ELMO domain 1|LST3|RBM29|MGC111036|C330008I15Rik|RNA binding motif protein 29
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human ELMOD3. Peptide sequence FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF.
- Purification:Immunogen affinity purified
- Cat. No.:102215-290
- Supplier no.:NBP1-79821
Specifications
About this item
The RBED1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBED1. This antibody reacts with human. The RBED1 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: RBED1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human