Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:Ribonucleic Acid Export 1
- Antigen Symbol:RAE1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:8480
- Antigen Synonyms:mRNA-associated protein mrnp 41|MIG14|MGC126076|mRNA-binding protein|mRNA export factor|dJ481F12.3|mRNA export protein|migration-inducing gene 14|MGC126077|MRNP41|Mnrp41|S.pombe) homolog|homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer)|MGC117333|FLJ30608|Rae1 protein homolog|41-kD|dJ800J21.1|RAE1 RNA export 1 homolog (S. pombe)|RAE1 (RNA export 1
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to RAE1 (RAE1 RNA export 1 homolog (S. pombe)) The peptide sequence was selected from the C terminal of RAE1. Peptide sequence EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE.
- Purification:Immunogen affinity purified
- Cat. No.:102189-272
- Supplier no.:NBP1-57186
The RAE1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAE1. This antibody reacts with human. The RAE1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: RAE1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human