Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:PHACS
- Antigen Symbol:PHACS
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Gene ID:84680
- Antigen Synonyms:PHACSACSACC synthase-like protein 1|1-aminocyclopropane-1-carboxylate synthase homolog(Arabidopsis)(non-functional)|1-aminocyclopropane-1-carboxylate synthase-like protein 1
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to PHACS The peptide sequence was selected from the middle region of PHACS. Peptide sequence RSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGTLYTENQDVATAVASLC.
- Purification:Protein A purified
- Cat. No.:102183-154
- Supplier no.:NBP1-52839
Specifications
About this item
The PHACS Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHACS. This antibody reacts with human. The PHACS Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: PHACS
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human