Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Olfactory Receptor, Family 13, Subfamily C Member 5
- Antigen Symbol:OR13C5
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:138799
- Antigen Synonyms:olfactory receptor 13C5|family 13|subfamily C|member 5|olfactory receptor
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the N terminal of human OR13C5. Peptide sequence CYTTTSIPSTLVSFLSERKTISLSGCAVQMFLSLAMGTTECVLLGVMAFD.
- Purification:Immunogen affinity purified
- Cat. No.:102215-636
- Supplier no.:NBP1-79994
Specifications
About this item
The OR13C5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OR13C5. This antibody reacts with human. The OR13C5 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: OR13C5
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human