Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:NADH dehydrogenase 6
- Antigen Symbol:ND6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:4541
- Antigen Synonyms:MTND6|NADH dehydrogenase|subunit 6 (complex I)|MT-ND6|NADH dehydrogenase subunit 6|mitochondrially encoded NADH dehydrogenase 6|NADH6
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to ND6(NADH dehydrogenase, subunit 6 (complex I)) The peptide sequence was selected from the middle region of ND6. Peptide sequence DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT.
- Purification:Immunogen affinity purified
- Cat. No.:102199-908
- Supplier no.:NBP1-70650
Specifications
About this item
Rabbit Polyclonal ND6 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Type: Primary
Antigen: ND6
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human