To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:MTAC2D1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Environmentally Preferable:
- Gene ID:123036
- Antigen Synonyms:Tac2-NC14orf47|nuclear|C2CD1|Tandem C2 protein in nucleus|tandem C2 domains|Membrane targeting tandem C2 domain-containing protein 1|tandem C2 domains nuclear protein|FLJ36557|membrane targeting (tandem) C2 domain containing 1|chromosome 14 open reading frame 47|MTAC2D1|C2 calcium-dependent domain containing 1
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to TC2N(tandem C2 domains, nuclear) The peptide sequence was selected from the middle region of TC2N. Peptide sequence SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ.
- Purification:Immunogen affinity purified
- Cat. No.:102185-788
- Supplier no.:NBP1-55422
Specifications
About this item
Rabbit Polyclonal MTAC2D1 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse.
Type: Primary
Antigen: MTAC2D1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human