Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Symbol:MTAC2D1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:123036
- Antigen Synonyms:Tac2-NC14orf47|nuclear|C2CD1|Tandem C2 protein in nucleus|tandem C2 domains|Membrane targeting tandem C2 domain-containing protein 1|tandem C2 domains nuclear protein|FLJ36557|membrane targeting (tandem) C2 domain containing 1|chromosome 14 open reading frame 47|MTAC2D1|C2 calcium-dependent domain containing 1
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to TC2N(tandem C2 domains, nuclear) The peptide sequence was selected from the middle region of TC2N. Peptide sequence SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ.
- Purification:Immunogen affinity purified
- Cat. No.:102185-788
- Supplier no.:NBP1-55422
Specifications
About this item
Rabbit Polyclonal MTAC2D1 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse.
Type: Primary
Antigen: MTAC2D1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human