Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:Matrix Metalloproteinase 16
- Antigen Symbol:MMP-16/MT3-MMP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:4325
- Antigen Synonyms:MT3-MMPC8orf57|Membrane-type matrix metalloproteinase 3|MMP-16|chromosome 8 open reading frame 57|MT-MMP 3|Putative transmembrane protein C8orf57|EC 3.4.24.80|Membrane-type-3 matrix metalloproteinase|DKFZp761D112|MT-MMP2|matrix metallopeptidase 16 (membrane-inserted)|MTMMP3|MMP-X2|MT-MMP3|MMPX2|EC 3.4.24|EC 3.4.24.-|matrix metalloproteinase-16|matrix metalloproteinase 16 (membrane-inserted)|MT3MMP
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA.
- Purification:Immunogen affinity purified
- Cat. No.:102198-916
- Supplier no.:NBP1-69349
Rabbit Polyclonal MMP16 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse, Rat, Bovine, Chicken, Rabbit.
Type: Primary
Antigen: MMP16
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human