Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Membrane Frizzled-related Protein
- Antigen Symbol:MFRP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:83552
- Antigen Synonyms:NNO2|RD6|MCOP5|membrane frizzled-related protein|Membrane-type frizzled-related protein|MGC32938
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to MFRP(membrane frizzled-related protein) The peptide sequence was selected from the N terminal of MFRP. Peptide sequence TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE.
- Purification:Immunogen affinity purified
- Cat. No.:102192-922
- Supplier no.:NBP1-59617
Specifications
About this item
Rabbit Polyclonal MFRP Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Type: Primary
Antigen: MFRP
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human