To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Name:LIM Domain Binding 3
- Antigen Symbol:LDB3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Gene ID:11155
- Antigen Synonyms:ZASPLVNC3|CMD1C|PDLIM6|KIAA0613FLJ35865|LDB3Z4|KIAA01613|Z-band alternatively spliced PDZ-motif protein|PDZ and LIM domain 6|LDB3Z1|LIM domain binding 3|ORACLE|CYPHER|LIM domain-binding protein 3|Protein cypher
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to LDB3(LIM domain binding 3) The peptide sequence was selected from the N terminal of LDB3. Peptide sequence PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS.
- Purification:Protein A purified
- Cat. No.:102184-952
- Supplier no.:NBP1-54998
Specifications
About this item
Rabbit Polyclonal LDB3 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human, Mouse.
Type: Primary
Antigen: LDB3
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype:
Reactivity: Human