Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Activin C/Inhibin beta C
- Antigen Symbol:INHBC
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:3626
- Antigen Synonyms:IHBC|inhibin|inhibin beta C chain|beta C
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:The immunogen for this antibody is INHBC - N-terminal region. Peptide sequence QECEIISFAETGLSTINQTRLDFHFSSDRTAGDREVQQASLMFFVQLPSN.
- Purification:Immunogen affinity purified
- Cat. No.:102222-912
- Supplier no.:NBP1-98297
Specifications
About this item
The Activin C / Inhibin beta C Antibody from Novus Biologicals is a rabbit polyclonal antibody to Activin C / Inhibin beta C. This antibody reacts with human. The Activin C / Inhibin beta C Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: Activin C/Inhibin beta C
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human