Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:F-Box Protein 11
- Antigen Symbol:FBXO11
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Reactivity:Amphibian,Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:80204
- Antigen Synonyms:UBR6|vitiligo-associated protein VIT-1|F-box protein 11|FLJ12673|Vitiligo-associated protein 1|FBX11MGC44383|VIT-1|ubiquitin protein ligase E3 component n-recognin 6|F-box only protein 11|PRMT9VIT1protein arginine N-methyltransferase 9
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to FBXO11(F-box protein 11) The peptide sequence was selected from the middle region of FBXO11 (NP_079409). Peptide sequence HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ.
- Purification:Immunogen affinity purified
- Cat. No.:102185-082
- Supplier no.:NBP1-55066
Specifications
About this item
The FBXO11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO11. This antibody reacts with human, amphibian. The FBXO11 Antibody has been validated for the following applications: Western Blot, Chromatin Immunoprecipitation.
Type: Primary
Antigen: FBXO11
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Amphibian