Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:DNA Primase small subunit
- Antigen Symbol:DNA Primase small Subunit
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100μl
- Gene ID:5557
- Antigen Synonyms:primase|MGC12308|DNA|primase polypeptide 1|p49|primase p49 subunit|EC 2.7.7|DNA primase small subunit|polypeptide 1 (49kDa)|DNA primase 1|DNA primase subunit 48|EC 2.7.7.-|DNA primase 49 kDa subunit|49kDa
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to PRIM1(primase, polypeptide 1, 49kDa) The peptide sequence was selected from the N terminal of PRIM1. Peptide sequence SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM.
- Purification:Protein A purified
- Cat. No.:102191-052
- Supplier no.:NBP1-58184
Specifications
About this item
The DNA Primase small subunit Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNA Primase small subunit. This antibody reacts with human. The DNA Primase small subunit Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: DNA Primase small subunit
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human