To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Antibody Type:Primary
- Antigen Symbol:CLEC-2/CLEC-1B
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Mouse
- Western Blot:Yes
- Size:100 μl
- Gene ID:51266
- Antigen Synonyms:CLEC2PRO1384|C-type lectin-like receptor 2|CLEC2B|member B|C-type lectin-like receptor-2|C-type lectin domain family 1|1810061I13Rik|C-type lectin domain family 1 member B|CLEC-2|QDED721
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:The immunogen for this antibody is Clec1b. Peptide sequence MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL.
- Purification:Immunogen affinity purified
- Cat. No.:102214-054
- Supplier no.:NBP1-79203
Specifications
About this item
The CLEC-2 / CLEC-1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CLEC-2 / CLEC-1B. This antibody reacts with mouse. The CLEC-2 / CLEC-1B Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: CLEC-2/CLEC-1B
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse