Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Symbol:Ces2a
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Mouse
- Western Blot:Yes
- Size:100μl
- Gene ID:102022
- Antigen Synonyms:carboxylesterase 2A
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the middle region of human CES6. Peptide sequence MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL.
- Purification:Protein A purified
- Cat. No.:102217-778
- Supplier no.:NBP1-91620
The Ces2a Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ces2a. This antibody reacts with mouse. The Ces2a Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: Ces2a
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse