Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Cysteine conjugate-beta lyase 2
- Antigen Symbol:CCBL2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:56267
- Antigen Synonyms:kynurenine-oxoglutarate transaminase 3|EC 2.6.1.63|kynurenine--oxoglutarate transaminase 3|RP4-531M19.2|RP11-82K18.3|Cysteine-S-conjugate beta-lyase 2|KAT3DKFZp667D0223|KATIII|Kynurenine--glyoxylate transaminase|DKFZp547N1117|RBM1|EC 2.6.1.7|EC 4.4.1.13|Kynurenine--oxoglutarate transaminase III|MGC9398|cysteine conjugate-beta lyase 2|Kynurenine aminotransferase III
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to CCBL2(cysteine conjugate-beta lyase 2) The peptide sequence was selected from the C terminal of CCBL2. Peptide sequence LSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS.
- Purification:Immunogen affinity purified
- Cat. No.:102189-856
- Supplier no.:NBP1-57482
Specifications
About this item
The CCBL2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCBL2. This antibody reacts with human. The CCBL2 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: CCBL2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human