Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Symbol:SZRD1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:26099
- Antigen Synonyms:Putative MAPK-activating protein PM18/PM20/PM22|chromosome 1 open reading frame 144|putative MAPK activating protein PM20|DKFZp566C0424|MGC70432|PM21|C1orf144
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to C1orf144 (chromosome 1 open reading frame 144) The peptide sequence was selected from the N terminal of C1orf144)(50ug). Peptide sequence MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN.
- Purification:Immunogen affinity purified
- Cat. No.:102190-354
- Supplier no.:NBP1-57737
The SZRD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SZRD1. This antibody reacts with human. The SZRD1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence.
Type: Primary
Antigen: SZRD1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human