Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Beta-1,3-N-acetylgalactosaminyltransferase 1
- Antigen Symbol:B3GALNT1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:8706
- Antigen Synonyms:Globoside synthase|UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase|polypeptide 3 (Globosideblood group)|P blood group globoside|Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase|globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase|beta-3-Gx-T3|Beta-1,3-galactosyltransferase 3|brainiac1|Gb4Cer|P|UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase|beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)|UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase|Beta3Gal-T3|b3Gal-T3|polypeptide 1(Globoside blood group)|UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1|EC 2.4.1.79|Beta3GalT3|Beta-1,3-GalNAc-T1|P antigen synthase|Beta-1,3-GalTase 3|GLCT3
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDT
- Purification:Immunogen affinity purified
- Cat. No.:102192-588
- Supplier no.:NBP1-59448
Specifications
About this item
The B3GALNT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to B3GALNT1. This antibody reacts with human. The B3GALNT1 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: B3GALNT1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human