Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:AT Rich Interactive Domain 3C
- Antigen Symbol:ARID3C
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:138715
- Antigen Synonyms:ARID domain-containing protein 3C|AT-rich interactive domain-containing protein 3C|AT rich interactive domain 3C (BRIGHT-like)|AT rich interactive domain 3C (BRIGHT- like)
- Storage Buffer:PBS and 2% Sucrose
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human ARID3CThe immunogen for this antibody is ARID3C (NP_001017363). Peptide Sequence: MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
- Purification:Immunogen affinity purified
- Cat. No.:102214-374
- Supplier no.:NBP1-79363
Specifications
About this item
The ARID3C Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARID3C. This antibody reacts with human. The ARID3C Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: ARID3C
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human