Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Antibody Type:Primary
- Antigen Name:All-Trans Retinoic Acid-Induced Differentiation Factor
- Antigen Symbol:APR3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 μl
- Gene ID:51374
- Antigen Synonyms:apoptosis-related protein 3|p18PRO240|APR--3|apoptosis related protein APR-3|HSPC013|apoptosis related protein 3|APR-3|chromosome 2 open reading frame 28|APR3
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptide directed towards the C terminal of human C2orf28. Peptide sequence VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS.
- Purification:Immunogen affinity purified
- Cat. No.:102215-586
- Supplier no.:NBP1-79969
The APR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 42828. This antibody reacts with human. The APR3 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: APR3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human