Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
Specifications
- Antibody Type:Primary
- Antigen Name:Adaptor-related Protein Complex 3, beta 1 Subunit
- Antigen Symbol:AP3B1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat
- Western Blot:Yes
- Size:100 μl
- Gene ID:8546
- Antigen Synonyms:Adaptor protein complex AP-3 subunit beta-1|HPS|HPS2AP-3 complex beta-3A subunit|ADTB3|ADTB3APE|Adapter-related protein complex 3 subunit beta-1|adaptor-related protein complex 3|beta 1 subunit|beta-3A-adaptin|Clathrin assembly protein complex 3 beta-1 large chain|AP-3 complex subunit beta-1|beta3A-adaptin
- Storage Buffer:PBS & 2% Sucrose.
- Storage Temperature:Store at -20C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
- Purification:Immunogen affinity purified
- Cat. No.:102198-202
- Supplier no.:NBP1-68927
Specifications
About this item
The AP3B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP3B1. This antibody reacts with rat. The AP3B1 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: AP3B1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Rat