Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Tag sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTGGGSGIEGRGSMGYRGSEF
- Storage Conditions:–20 °C
- Endotoxin Content:<1.0 EU per 1 μg (determined by the LAL method)
- Gene ID:1991
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Neutrophil Elastase
- UniProtKB:P08246
- Protein/Peptide Name:NE
- Purity:80 - 100%
- Molecular Weight:53/28 kDa
- Sequence:Ile30~Gln247
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4 containing 0.01% SKL, 5% trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPA181HU1
Specifications
About this item
This is a NE recombinant protein (prokaryotic), Human is sequencing from Ile30~Gln247 with 80 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
Neutrophil elastase is a serine protease in the same family as chymotrypsin and has broad substrate specificity. Secreted by neutrophils during inflammation, it destroys bacteria and host tissue. As with other serine proteases it contains a charge relay system composed of the catalytic triad of histidine, aspartate, and serine residues that are dispersed throughout the primary sequence of the polypeptide but that are brought together in the three dimension conformation of the folded protein. The gene encoding neutrophil elastase, ELA2, consists of five exons. The neutrophil form of elastase is 218 amino acids long, with two asparagine-linked carbohydrate chains. It is present in azurophil granules in the neutrophil cytoplasm. There appear to be two forms of neutrophil elastase, termed IIa and IIb.