- Pack type:Vial
- Conjugation:Unconjugated
- Protein Function:Bio-Markers & CD Antigens
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Tag sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDGSTSGSGHHHHHHSAGLVPRGSTAIGMKETAAAKFERQHMDSPDLGTGGGSGIEGRGSMGYRGSEF
- Storage Conditions:–20 °C
- Endotoxin Content:<1.0 EU per 1 μg (determined by the LAL method)
- Gene ID:1830
- Reconstitution Instructions:Reconstitute in 10 mM PBS (pH 7.4) to a concentration of 0.1 - 1.0 mg/ml. Do not vortex.
- Endotoxin-free:N
- Carrier-Free:Y
- Protease-free:N
- Animal-Free:Y
- Protein Synonyms:Desmoglein 3
- UniProtKB:P32926
- Protein/Peptide Name:DSG3
- Purity:90 - 100%
- Molecular Weight:45 kDa
- Sequence:Glu858~Ile999
- Endotoxin Level:Low
- Concentration:0.2 mg/ml
- Formulation:Lyophilized from PBS, pH 7.4 containing 0.01% SKL, 5% trehalose
- Nuclease-free:N
- Shipping Temperature:4 °C
- Tested Applications:Positive control, Immunogen, SDS-PAGE, Western blot.
- Cat. No.:MSPP-RPA444HU1
This is a DSG3 recombinant protein (prokaryotic), Human is sequencing from Glu858~Ile999 with 90 to 100% purity. LyopH ilized from PBS, pH 7.4, containing 0.01% SKL, 5% Trehalose with 0.2 mg/ml.
- High quality, purity, reproducibility and effectiveness
- Offers customized buffers and tag options
- 100% quality and service satisfaction guarantee
Pemphigus vulgaris (PV) and pemphigus foliaceus (PF) are autoimmune diseases of the skin which have as target antigens 2 different members of the desmoglein subfamily of the desmosomal cadherins: pemphigus vulgaris antigen (PVA) in the case of PV and desmoglein I in the case of PF. In pemphigus vulgaris, autoantibodies against PVA, a keratinocyte cell surface 130-kDa glycoprotein, cause loss of cell-cell adhesion.
Amagai et al. used affinity-purified pemphigus vulgaris IgG to isolate cDNA, containing the entire coding sequence for PVA, from human keratinocyte expression libraries. Northern blot analysis indicated PV mRNA expression only in stratified squamous epithelia.