Human Recombinant IL12 (from HEK293 cells)
New Product
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:HEK293 cells
- Species:Human
- Storage Conditions:4 °C
- Endotoxin Content:<0.1 EU/µg
- Biological Activity:Measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is typically 0.5 ng/ml.
- Reconstitution Instructions:Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100 µg/ml. Dissolve the lyophilized protein in ddH₂O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:Interleukin 12
- UniProtKB:P29459, P29460
- Protein/Peptide Name:IL12
- Purity:Greater than 95% as determined by reducing SDS-PAGE
- Sequence:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
- Endotoxin Level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
Frequently Bought Together
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Disposable Petri Dishes
: VWR International
VWR® Powder-Free Nitrile Examination Gloves
: VWR International