Human Recombinant IL11 (from E. coli)
Supplier: Creative Biomart
New Product
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Storage Conditions:4 °C
- Endotoxin Content:<1 EU/µg of rHuIL-11 as determined by LAL method
- Biological Activity:Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine B9-11 cells is less than 1 ng/ml, corresponding to a specific activity of >1.0×10⁶ IU/mg.
- Reconstitution Instructions:Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1 - 1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤−20 °C. Further dilutions should be made in appropriate buffered solutions.
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:interleukin 11
- UniProtKB:P20809
- Protein/Peptide Name:IL11
- Purity:>95% by SDS-PAGE and HPLC analyses
- Molecular Weight:Approximately 19.1 kDa, a single non-glycosylated polypeptide chain containing 179 amino acids
- Sequence:MPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
- Endotoxin Level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
Specifications
Frequently Bought Together