Hirudo Recombinant Hirudin (from Pichia pastoris)
Supplier: Creative Biomart
New Product
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:Pichia pastoris
- Species:Hirudo
- Storage Conditions:4 °C
- Endotoxin Content:<1 EU/μg of rHirudin as determined by LAL method
- Reconstitution Instructions:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1 - 1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤−20 °C. Further dilutions should be made in appropriate buffered solutions.
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:Hirudin
- UniProtKB:P84590
- Protein/Peptide Name:Hirudin
- Purity:>96% by SDS-PAGE and HPLC analysis
- Molecular Weight:Approximately 6.7 kDa, a single non-glycosylated polypeptide chain containing 63 amino acid residues
- Sequence:VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL
- Endotoxin Level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
Specifications
Frequently Bought Together