Monkeypox virus Recombinant B6R (from HEK293 cells)
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:HEK293 cells
- Species:Monkeypox virus
- Storage Conditions:4 °C
- Endotoxin Content:<1 EU/μg
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:B6R
- Protein/Peptide Name:B6R
- Purity:>90% by SDS-PAGE
- Molecular Weight:The protein has a calculated MW of 29.6 kDa
- Sequence:TCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHHHHHHH
- Endotoxin Level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
Frequently Bought Together
VWR® Lab Markers
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International