Human Recombinant CLEC11A (from E. coli)
Catalog # 77539-082
Supplier: Creative Biomart
New Product
CAS Number:
Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Storage Conditions:4 °C
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:C-type lectin domain family 11, member A
- UniProtKB:Q9Y240
- Protein/Peptide Name:CLEC11A
- Purity:>90% by SDS-PAGE
- Sequence:MASMTGGQQMGRGHHHHHHENLYFQGGEFARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAGRGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHALDTRVVELTQGLRQLRNAAGDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTARGGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRSPRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
- Endotoxin Level:Low
- Concentration:0.5 mg/ml
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
- Tested Applications:May be used for in vitro glycosylated CLEC11A protein mediated HSC regulation study with this protein as either coating matrix protein or as soluble factor. May be used for CLEC11A protein – protein interaction assay. May be used as enzymatic substrate for various proteases. May be used for specific antibody production.
- Cat. No.:77539-082