Recombinant Human LCK (from E. coli)
Catalog # 77540-106
Supplier: Creative Biomart
New Product
CAS Number:
Specifications
- Pack type:Vial
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:50 µg
- Storage Conditions:4 °C
- Reconstitution Instructions:It is recommended that sterile water be added to the vial to prepare a stock solution of 0.42 μg/μl. Centrifuge the vial at 4 centigarde before opening to recover the entire contents.
- Endotoxin-free:No
- Carrier-Free:No
- Protease-free:No
- Animal-Free:No
- Protein Synonyms:lymphocyte-specific protein tyrosine kinase
- UniProtKB:P06239
- Protein/Peptide Name:LCK
- Purity:>90%, by SDS-PAGE
- Molecular Weight:The protein has a calculated MW of 33 kDa.
- Sequence:MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANS
- Endotoxin Level:Low
- Nuclease-free:No
- Grade:Ultrapure grade
- Shipping Temperature:20
- Cat. No.:77540-106