Anti-Tec Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to Tec for WB, IHC and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: Tec
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
- Catalog No:
- 76868-300
- Antigen Symbol:
- Tec
- Antigen Name:
- MGC126760
- Antigen Synonyms:
- PSCTK4|Tec protein tyrosine kinase|Tec|Tyrosine protein kinase|MGC126762|TEC_HUMAN|Tyrosine-protein kinase Tec
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# P42680
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Tec (NP_003206.2)
- Sequence:
- MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGL
- Form:
- Liquid
- Molecular Weight:
- 68 kDa
- Purification:
- Affinity purification.
- Storage Buffer:
- Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
- Tested Applications:
- IHC, ICC/IF
Frequently Bought Together
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International