Anti-Apolipoprotein A V / APOA5 Rabbit Polyclonal Antibody
Rabbit polyclonal antibody to Apolipoprotein A V / APOA5 for WB with samples derived from Human and Mouse.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: Apolipoprotein A V / APOA5
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse
- Catalog No:
- 76863-322
- Antigen Symbol:
- Apolipoprotein A V / APOA5
- Antibody Type:
- Primary
- Clonality:
- Polyclonal
- Conjugation:
- Unconjugated
- Reactivity:
- Human, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q6Q788
- Isotype:
- IgG
- Western Blot:
- Yes
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 207-366 of human APOA5 (NP_443200.2)
- Sequence:
- QELHRSVAPHAPASPARLSRCVQVLSRKLTLKAKALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP
- Form:
- Liquid
- Molecular Weight:
- 41 kDa
- Purification:
- Affinity purification.
- Storage Buffer:
- Supplied in Phosphate buffered saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at +4 °C
Frequently Bought Together
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
VWR® Disposable Petri Dishes
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
VWR® Powder-Free Nitrile Examination Gloves
: VWR International