Anti-Lefty Rabbit Monoclonal Antibody [clone: ARC2149]
Rabbit monoclonal [ARC2149] antibody to Lefty for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Lefty
Clonality: Monoclonal
Clone: ARC2149
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
- Catalog No:
- 77219-354
- Antigen Symbol:
- Lefty
- Antigen Name:
- AI450052
- Antigen Synonyms:
- LEFTY1|Ebaf|Left right determination factor B|Left right determination factor 1|Left right determination factor| LEFTY B|LEFT-RIGHT DETERMINATION FACTOR 1|left-right determination, factor B|left-right determination factor
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2149
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# O75610, O00292
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 267-366 of human LEFTY1/2 (O75610).
- Sequence:
- EMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP
- Form:
- Liquid
- Molecular Weight:
- 41 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- IHC
Frequently Bought Together
VWR® Lab Markers
: VWR International
VWR® Broken Glass Disposal Cartons
: VWR International
VWR® Disposable Serological Pipettes
: VWR International
VWR® Powder-Free Nitrile Examination Gloves
: VWR International
VWR® Universal Pipette Tips
: VWR International
VWR® Nitrile Examination Gloves, Black
: VWR International
VWR® Microcentrifuge Tubes, PP
: VWR International
VWR® High-Performance Centrifuge Tubes with Flat or Plug Caps, PP
: VWR International
PURPLE NITRILE™ and PURPLE NITRILE-XTRA™ Examination Gloves, Kimberly-Clark
: Ansell Healthcare
VWR® Disposable Petri Dishes
: VWR International
Clorox® Concentrated Germicidal Bleach
: Janitorial Supplies