Anti-VPS15 Rabbit Monoclonal Antibody [clone: ARC2090]
Supplier: ANTIBODIES.COM LLC
Certificates
About this item
Rabbit monoclonal [ARC2090] antibody to VPS15 for WB and ICC/IF with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2,000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: VPS15
Clonality: Monoclonal
Clone: ARC2090
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat
Specifications
- Catalog No:
- 77217-650
- Antigen Symbol:
- VPS15
- Antigen Name:
- MGC102700
- Antigen Synonyms:
- Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4|Phosphoinositide 3 kinase regulatory subunit polypeptide 4 p150|Phosphoinositide 3 kinase regulatory subunit 4 p150|Phosphatidylinositol 3 kinase regulatory subunit polypeptide 4 p150|Phosphoinositide 3 kinase regulatory subunit polypeptide 4|Phosphoinositide 3 kinase adaptor protein|Phosphoinositide 3 kinase regulatory subunit 4|P150|Phosphatidylinositol 3 kinase associated p150
- Antibody Type:
- Primary
- Clonality:
- Monoclonal
- Conjugation:
- Unconjugated
- Clone:
- ARC2090
- Reactivity:
- Human, Rat, Mouse
- Host:
- Rabbit
- Gene ID:
- UniprotID# Q99570
- Isotype:
- IgG
- Western Blot:
- Yes
- ImmunoChemistry:
- Yes
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 1259-1358 of human PIK3R4/VPS15 (Q99570).
- Sequence:
- AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
- Form:
- Liquid
- Molecular Weight:
- 153 kDa
- Purification:
- Affinity purification
- Storage Buffer:
- Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide
- Storage Temperature:
- Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping Temperature:
- Shipped on blue ice at 4 °C
- Tested Applications:
- ICC/IF
Specifications
Frequently Bought Together